HORDB

ID: hor004637
Uniprot ID: Q9LXU0
Protein name: CLAVATA3/ESR (CLE)-related protein 40
Gene name: CLE40
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE40p]: Expressed in the entire embryo at the globular stage. Progressively restricted to the basal regions of the embryo that form the root meristem and the vasculature. After germination, detected in the differentiation zone of the stele that forms th
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0001708 cell fate specification; GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: HSSSTKSFFWLGETQDTKAMKKEKKIDGGTANEVEERQVPTGSDPLHHKHIPFTP
Length: 55
Propeptide: MAAMKYKGSVFIILVILLLSSSLLAHSSSTKSFFWLGETQDTKAMKKEKKIDGGTANEVEERQVPTGSDPLHHKHIPFTP
Signal peptide: MAAMKYKGSVFIILVILLLSSSLLA
Modification: T40 Hydroxyproline
Glycosylation: NA
Mutagenesis: NA

Function: Extracellular signal peptide secreted by differentiated root cells that regulates root cell fate. Acts with ACR4 as a ligand-receptor pair in a signal transduction pathway, coordinating movement of the root tip and organization of cell divisions in the root meristem. Promotes cell differentiation in the distal root meristem in a dose-dependent manner, especially the transition from columella stem cells (CSC) daughters into columella cells (CCs). Induces ACR4 expression in root quiescent center (QC). Involved in WUX5 QC-specific expression pattern regulation.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004637_AF2.pdb

hor004637_ESM.pdb

Mass:	715523	Formula:	C273H423N77O86S
Absent amino acids:	CY	Common amino acids:	KT
pI:	7.87	Basic residues:	12
Polar residues:	16	Hydrophobic residues:	12
Hydrophobicity:	-111.45	Boman Index:	-13400
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	42.55
Instability Index:	4153.82	Extinction Coefficient cystines:	5500
Absorbance 280nm:	101.85